DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and F9

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_000124.1 Gene:F9 / 2158 HGNCID:3551 Length:461 Species:Homo sapiens


Alignment Length:366 Identity:91/366 - (24%)
Similarity:147/366 - (40%) Gaps:78/366 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CFWTLTETGAPCGLQMEC-VPQG----LCKTSAWNQNAISWPSPCQRSESCCHSSQKLVIGAPLN 70
            |:......|..|.|.:.| :..|    .||.||.|:...|    |........:.:......|..
Human   117 CWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCS----CTEGYRLAENQKSCEPAVPFP 177

  Fly    71 CGK----------------SNPNGLGGTVEEVV--------------------DQAKPNEFPWTV 99
            ||:                .:.:.:..|..|.:                    :.|||.:|||.|
Human   178 CGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPWQV 242

  Fly   100 ALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHP 164
            .| ...::.|..|::|.|..::||||.:  :|.....::.|..:::: ...|.|.|...||:.|.
Human   243 VL-NGKVDAFCGGSIVNEKWIVTAAHCV--ETGVKITVVAGEHNIEE-TEHTEQKRNVIRIIPHH 303

  Fly   165 DFNKMTGANN--IALIVLETSFVMKPPIGPICWPTSGVSFDRERC---------LVAGWGRPDFL 218
            ::|......|  |||:.|:...|:...:.|||      ..|:|..         .|:||||. |.
Human   304 NYNAAINKYNHDIALLELDEPLVLNSYVTPIC------IADKEYTNIFLKFGSGYVSGWGRV-FH 361

  Fly   219 AKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG-GERGRDACIGDGGSPLMCPI 282
            ....:...:.:.:|:|.|:.|   ||.|    .|.:...:.||| .|.|||:|.||.|.|.:..:
Human   362 KGRSALVLQYLRVPLVDRATC---LRST----KFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEV 419

  Fly   283 PGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQ 323
            .|...   |.||::.|..|.::....:||.:|....||:::
Human   420 EGTSF---LTGIISWGEECAMKGKYGIYTKVSRYVNWIKEK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 73/246 (30%)
Tryp_SPc 90..320 CDD:214473 71/241 (29%)
F9NP_000124.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011 2/11 (18%)
FXa_inhibition 134..170 CDD:317114 9/39 (23%)
Tryp_SPc 227..457 CDD:238113 73/250 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.