DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and C1s

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_620255.2 Gene:C1s / 192262 RGDID:619983 Length:694 Species:Rattus norvegicus


Alignment Length:433 Identity:100/433 - (23%)
Similarity:150/433 - (34%) Gaps:153/433 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WTLTETGAPCGLQMECVPQGLCKTSAW--------------------------NQNAISWPSPCQ 51
            |.|...|.|    :.| |:.:...|.|                          |..:.|:.|.||
  Rat   289 WKLRYHGDP----IPC-PKEISANSIWEPEKAKYVFKDVVKITCVDGFEVVEGNVGSTSFYSTCQ 348

  Fly    52 RSESCCHSSQKLVIGAPLNCGKSNP--NG-------------LGGTVEE---------------- 85
            .:....:|..:.   .|::||...|  ||             :..|.||                
  Rat   349 SNGQWSNSRLEC---QPVDCGVPEPIENGKVEDPEDTVFGSVIHYTCEEPYYYMEQEEGGEYHCA 410

  Fly    86 -----VVDQ------------------------------AKPNEFPWTVALMQNLINFF----GA 111
                 |.||                              .|...|||.|        :|    |.
  Rat   411 ANGSWVNDQLGVELPKCIPVCGVPTEPFKVQQRIFGGYSTKIQSFPWQV--------YFESPRGG 467

  Fly   112 GTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTI----QWRTATRIVS-----HP--- 164
            |.|:.|..|:||||           ::.|..|.....|.|:    :.|.|.|:::     ||   
  Rat   468 GALIDEYWVLTAAH-----------VVEGNSDPVMYVGSTLLKIERLRNAQRLITERVIIHPSWK 521

  Fly   165 ---DFNKMTG-ANNIALIVLETSFVMKPPIGPICWPTSGVSF---DRERCLVAGWGRPDFLAKNY 222
               |.|..|. .|:|||:.|:....|.|.:.|||.|.:...:   :.:..|::||||.:......
  Rat   522 QEDDLNTRTNFDNDIALVQLKDPVKMGPTVAPICLPETSSDYNPSEGDLGLISGWGRTENRTNVI 586

  Fly   223 SYKQKKIDLPIVSRSDCESLLRRTAFVQS--FQLDPTILCAGGERGRDACIGDGGSPLMCPIPG- 284
            ..:..|  |||.|...|:.:.......:|  :.....::|| ||:|.|:|.||.|.....|:|. 
  Rat   587 QLRGAK--LPITSLEKCQQVKVENPKARSNDYVFTDNMICA-GEKGVDSCEGDSGGAFALPVPNV 648

  Fly   285 -HPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLND 326
             .|..| :.|:|:.|..||...:   ||.:.:...||.|.:.:
  Rat   649 KDPKFY-VAGLVSWGKKCGTYGI---YTKVKNYVDWILKTMQE 687

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 75/291 (26%)
Tryp_SPc 90..320 CDD:214473 71/256 (28%)
C1sNP_620255.2 CUB 24..135 CDD:238001
FXa_inhibition 149..177 CDD:405372
CUB 181..293 CDD:395345 2/3 (67%)
CCP 300..361 CDD:153056 10/64 (16%)
CCP 365..428 CDD:153056 11/62 (18%)
Tryp_SPc 443..681 CDD:214473 71/263 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.