DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss8

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_620191.1 Gene:Prss8 / 192107 RGDID:619973 Length:342 Species:Rattus norvegicus


Alignment Length:303 Identity:91/303 - (30%)
Similarity:142/303 - (46%) Gaps:46/303 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GAPLNCGK-SNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLM-L 128
            |...:||. ..|...||      ..|||.::||.|::..|.::..| |:||:...|::|||.. .
  Rat    32 GTEASCGAVIQPRITGG------GSAKPGQWPWQVSITYNGVHVCG-GSLVSNQWVVSAAHCFPR 89

  Fly   129 DKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPI 193
            :.:..::.:..||..|...:...:. .|..:|:||..:.:.....:||||.|.:.......|.||
  Rat    90 EHSKEEYEVKLGAHQLDSFSNDIVV-HTVAQIISHSSYREEGSQGDIALIRLSSPVTFSRYIRPI 153

  Fly   194 CWPTSGVSFDRE-RCLVAGWGRPDFLAKNYSYKQ----KKIDLPIVSRSDCESLLRRTAFVQ--- 250
            |.|.:..||... .|.|.|||.   :|.:.|.:.    :::::|::||..|..|....|..:   
  Rat   154 CLPAANASFPNGLHCTVTGWGH---VAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPH 215

  Fly   251 SFQLDPTILCAGGER-GRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNIS 314
            :.|.|  :||||..: |:|||.||.|.||.|||.|   ::.|.|||:.|.:||..|.|.:||..|
  Rat   216 TIQQD--MLCAGYVKGGKDACQGDSGGPLSCPIDG---LWYLAGIVSWGDACGAPNRPGVYTLTS 275

  Fly   315 HMRPWI----------------EKQLNDELNKPYKTFPIYNIS 341
            ....||                |.|.:..|...:   |::|::
  Rat   276 TYASWIHHHVAELQPRAVPQTQESQPDGHLCNHH---PVFNLA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 81/260 (31%)
Tryp_SPc 90..320 CDD:214473 78/239 (33%)
Prss8NP_620191.1 Tryp_SPc 44..281 CDD:214473 80/252 (32%)
Tryp_SPc 45..284 CDD:238113 82/254 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.