DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Tpsb2

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:249 Identity:77/249 - (30%)
Similarity:116/249 - (46%) Gaps:30/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QAKPNEFPWTVALMQNL---INFFGAGTLVTENIVITAAHLMLD--KTINDFGIIGGAWDLKQLA 148
            :|..:::||.|:|...|   |:|.| |:|:....|:||||.:..  |:...|.:        ||.
Mouse    37 EASESKWPWQVSLRFKLNYWIHFCG-GSLIHPQWVLTAAHCVGPHIKSPQLFRV--------QLR 92

  Fly   149 GKTI----QWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSF-DRERCL 208
            .:.:    |..:..|||.||.:....|..::||:.||....:...:.||..|.:..:| ....|.
Mouse    93 EQYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVPVNVSTHLHPISLPPASETFPPGTSCW 157

  Fly   209 VAGWGRPDF---LAKNYSYKQKKIDLPIVSRSDCESLLRRTAFV-QSFQL-DPTILCAGGERGRD 268
            |.|||..|.   |...|..||.|:  |||..|.|:.......:. ..|.: ...:||||..| ||
Mouse   158 VTGWGDIDNDEPLPPPYPLKQVKV--PIVENSLCDRKYHTGLYTGDDFPIVHDGMLCAGNTR-RD 219

  Fly   269 ACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEK 322
            :|.||.|.||:|.:.|   .:...|:|:.|..|...|.|.:||.:::...||.:
Mouse   220 SCQGDSGGPLVCKVKG---TWLQAGVVSWGEGCAQPNKPGIYTRVTYYLDWIHR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 77/249 (31%)
Tryp_SPc 90..320 CDD:214473 75/244 (31%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 77/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.