DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CG12256

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster


Alignment Length:277 Identity:71/277 - (25%)
Similarity:120/277 - (43%) Gaps:47/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 SSQKLVIGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITA 123
            :||:.|:|             |..|.|  |:..|.:...........:..|..|:|:..|.|:||
  Fly    42 NSQERVVG-------------GYDVPE--DEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTA 91

  Fly   124 AHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVM-K 187
            ||.:..:..:...::.|..||...:|    :|:..:.....:..:....::||::.::..|.: :
  Fly    92 AHCVNGQNASRISVVAGIRDLNDSSG----FRSQVQSYEMNENYQELVTSDIAILKIDPPFELDE 152

  Fly   188 PPIGPICWPTSG---VSFDRERCLVAGWGR-------PDFLAKNYSYKQKKIDLPIVSRSDCESL 242
            ..:..|  ..||   |..|:| .|:.|||.       |  .|| |....:|:|...:|.|.|:..
  Fly   153 KRVSTI--DVSGSDMVGADQE-VLLTGWGSVFHFGTGP--FAK-YPTVLQKLDYKTLSNSKCKET 211

  Fly   243 LRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVP 307
            :.        ||..|.:||....|:.||.||.|.||:.. .|..  |:.||:|:.|.:....|.|
  Fly   212 MT--------QLTDTEICALERFGKGACNGDSGGPLVMK-SGES--YKQVGVVSYGTAFCASNNP 265

  Fly   308 ALYTNISHMRPWIEKQL 324
            .:||.:|....||::::
  Fly   266 DVYTRVSMFDGWIKERM 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 64/245 (26%)
Tryp_SPc 90..320 CDD:214473 61/240 (25%)
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 67/267 (25%)
Tryp_SPc 47..280 CDD:238113 69/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24256
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.