DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and F9

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:379 Identity:92/379 - (24%)
Similarity:152/379 - (40%) Gaps:94/379 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CFWTLTETGAPCGLQMEC-VPQGLCKTSAWN--QNAI-------------------SWPSPCQRS 53
            |:..:...|..|.|...| :..|.||....|  .|.:                   :.|.||.|:
Mouse   117 CWCQVGFEGRNCELDATCNIKNGRCKQFCKNSPDNKVICSCTEGYQLAEDQKSCEPTVPFPCGRA 181

  Fly    54 ESCCHSSQK-------------------------LVIGAPLNCGKSNPNGL-------GGTVEEV 86
             |..:||:|                         :..||.||....:...|       ||     
Mouse   182 -SISYSSKKITRAETVFSNMDYENSTEAVFIQDDITDGAILNNVTESSESLNDFTRVVGG----- 240

  Fly    87 VDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKT 151
             :.|||.:.||.| ::...|..|..|.::.|..::||||.:  |..:...::.|.:::.: ...|
Mouse   241 -ENAKPGQIPWQV-ILNGEIEAFCGGAIINEKWIVTAAHCL--KPGDKIEVVAGEYNIDK-KEDT 300

  Fly   152 IQWRTATRIVSHPDFNKMTG--ANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERC------- 207
            .|.|...|.:.|..:|....  :::|||:.|:...::...:.|||      ..:||..       
Mouse   301 EQRRNVIRTIPHHQYNATINKYSHDIALLELDKPLILNSYVTPIC------VANREYTNIFLKFG 359

  Fly   208 --LVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG-GERGRDA 269
              .|:|||:.....:..|..| .:.:|:|.|:.|   ||.|    :|.:...:.||| .|.|:|:
Mouse   360 SGYVSGWGKVFNKGRQASILQ-YLRVPLVDRATC---LRST----TFTIYNNMFCAGYREGGKDS 416

  Fly   270 CIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQ 323
            |.||.|.|.:..:.|...   |.||::.|..|.::....:||.:|....||:::
Mouse   417 CEGDSGGPHVTEVEGTSF---LTGIISWGEECAMKGKYGIYTKVSRYVNWIKEK 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 67/246 (27%)
Tryp_SPc 90..320 CDD:214473 65/241 (27%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011 2/11 (18%)
FXa_inhibition 134..170 CDD:291342 6/35 (17%)
Tryp_SPc 236..464 CDD:214473 67/254 (26%)
Tryp_SPc 237..467 CDD:238113 69/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.