DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP011669

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_320844.4 Gene:AgaP_AGAP011669 / 1280970 VectorBaseID:AGAP011669 Length:576 Species:Anopheles gambiae


Alignment Length:299 Identity:75/299 - (25%)
Similarity:118/299 - (39%) Gaps:57/299 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LNCGKSNPNGLGGTVEEVVDQ--------AKPNEFPWTVALMQN---LINFFGAGTLVTENIVIT 122
            |.|||          .:||.|        ||...:||.|||...   ...:...|:::.||.::|
Mosquito    28 LTCGK----------RKVVSQYLIHNGIDAKAGHWPWHVALFHRKDAQYEYACGGSILDENTILT 82

  Fly   123 AAHLMLDKTINDFGIIG--------GAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIV 179
            |:|.:..::    |:|.        |...|.:.:..| |......|:.||.|:|.:..|:||||.
Mosquito    83 ASHCVYTQS----GVISISRVSVDVGRIHLNESSEYT-QTHLVREIIVHPGFSKNSIVNDIALIK 142

  Fly   180 LETSFVMKPPIGPIC-WPTSGVSFDRERCLVAGWGRP--DFLAKNYSYKQKKIDLPIVSRSDCES 241
            |.::..|...:.|:| |     :.|..:.|:.|....  .|.........:::...::...|..|
Mosquito   143 LSSNITMNKYVQPVCLW-----TMDSNQELIVGRNGTIVGFGVNEQDVVSEQLKQALIGVVDPLS 202

  Fly   242 LLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGF-SC-GLE 304
            .:.....|....|...:.|..|::|..||.||.|..:...|.|...:..||.....|. .| .|:
Mosquito   203 CIADDRGVFGTHLTSDMFCGKGQKGVSACNGDSGGGMFFEIGGKWFVRGLVSFTPLGTEQCDSLK 267

  Fly   305 NVPALYTNISHMRPWIEKQLNDELNKPYKTFPIYNISYD 343
            |  ..||:::....||         |||....:  :|||
Mosquito   268 N--TAYTDVAKYLEWI---------KPYIDQRV--LSYD 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 63/258 (24%)
Tryp_SPc 90..320 CDD:214473 60/245 (24%)
AgaP_AGAP011669XP_320844.4 Tryp_SPc 41..282 CDD:238113 62/261 (24%)
Tryp_SPc 43..281 CDD:214473 60/249 (24%)
Tryp_SPc 330..568 CDD:214473
Tryp_SPc 330..568 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.