DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CLIPA7

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_320723.2 Gene:CLIPA7 / 1280856 VectorBaseID:AGAP011792 Length:821 Species:Anopheles gambiae


Alignment Length:272 Identity:96/272 - (35%)
Similarity:149/272 - (54%) Gaps:14/272 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 IGAPLNCGKSNPNGLGGTVEEVVD-QAKPNEFPWTVALMQ------NLINFFG-AGTLVTENIVI 121
            :..|..||..|.:|:|..:....| :::..||||.||:::      .:||.:. .|:|:..::|:
Mosquito   539 VSVPQKCGLRNVDGVGFRITGDNDGESEYGEFPWMVAILKEEKALDQVINVYQCGGSLIHPSVVL 603

  Fly   122 TAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQW--RTATRIVSHPDFNKMTGANNIALIVLETSF 184
            ||||.:.::.|.:..:..|.|| .|...:...:  |....||||.:..|....|::||:.|:...
Mosquito   604 TAAHCVQNRKIEEVKVRLGEWD-TQTKNEMFDYQDRNVVEIVSHAEIYKGGLFNDVALLFLDKPA 667

  Fly   185 VMKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAKNYSYK--QKKIDLPIVSRSDCESLLRRTA 247
            .:...:..||.|.:..:||..||..:|||: |...|..:|:  .|||:|||:...:|:..||.|.
Mosquito   668 DLMETVNTICLPPANHNFDMSRCFASGWGK-DVFGKQGTYQVILKKIELPIMPNEECQKALRTTR 731

  Fly   248 FVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTN 312
            ..:.|:|..:.:|||||:|||.|.|||||||:|||||....|...|:|..|..||.:.:|.:|.|
Mosquito   732 LGRRFKLHSSFICAGGEKGRDTCKGDGGSPLICPIPGSVNHYYQAGMVAWGIGCGEDGIPGVYVN 796

  Fly   313 ISHMRPWIEKQL 324
            :...|.||:..|
Mosquito   797 VPMFRGWIDDHL 808

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 89/246 (36%)
Tryp_SPc 90..320 CDD:214473 86/240 (36%)
CLIPA7XP_320723.2 BAT2_N <406..487 CDD:284431
Tryp_SPc 556..804 CDD:214473 87/249 (35%)
Tryp_SPc 564..807 CDD:238113 88/244 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24256
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.