DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP011793

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_320722.4 Gene:AgaP_AGAP011793 / 1280855 VectorBaseID:AGAP011793 Length:426 Species:Anopheles gambiae


Alignment Length:421 Identity:115/421 - (27%)
Similarity:177/421 - (42%) Gaps:108/421 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRRV-IFIRCCFWTL---TETGAPC--GLQMECVPQGLCKTSAWNQNA-------ISWPSPCQR 52
            :|.|: :.:..|....   :|...||  |   ||||...||:.....:.       ::....|..
Mosquito     2 LWCRIGLTLASCLLLAHGESEKAKPCDGG---ECVPVTKCKSGELEDHGAYVISLRLNPEDECSY 63

  Fly    53 SESCC-------------------------HSSQKLVIGA------------------------- 67
            .|:||                         .:.:.|.:.|                         
Mosquito    64 LETCCPYPKDEDDESRDELGELLKAPATGNGAGEALNVAAEQVPSVAAQRANLLSSSGANNVKSE 128

  Fly    68 ----------------PLNCGKSNPNGLGGTVEEVVD-QAKPNEFPWTVALMQ------NLIN-F 108
                            |..||..|.||:...:.:..| :::..||||..|:::      .:|| :
Mosquito   129 NLKAATNRPPTASATGPQTCGVRNSNGVQFRITDDSDGESEYGEFPWMAAILEEQKALDQIINTY 193

  Fly   109 FGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQW--------RTATRIVSHPD 165
            ...|:|:..::::||||.:.:.||....:..|.||       |..|        |....|..|..
Mosquito   194 MCGGSLIHPSVILTAAHCVQNITITALKVRLGEWD-------TRSWKEPFPHQDRRVVEIAFHEQ 251

  Fly   166 FNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAKNYSYKQ--KK 228
            |......||:||:.|:....:...:..||.|.:..:||..||:.:|||: |.......::.  ||
Mosquito   252 FFAPAALNNVALLFLDKPVELMETVNTICLPPANYTFDPVRCVASGWGK-DVFGNEGMFQAILKK 315

  Fly   229 IDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVG 293
            ::||::.|..|:..||.|...:.|:|..:.||||||:|||.|.|||||||:|||||....|....
Mosquito   316 VELPLMPRGACQRALRMTRLGRRFKLHESFLCAGGEKGRDTCKGDGGSPLVCPIPGVANGYYQAS 380

  Fly   294 IVNSGFSCGLENVPALYTNISHMRPWIEKQL 324
            ||..|.:||:|.||.:|.|::..|.||::||
Mosquito   381 IVAWGINCGIEGVPGVYVNVALFREWIDEQL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 88/252 (35%)
Tryp_SPc 90..320 CDD:214473 85/246 (35%)
AgaP_AGAP011793XP_320722.4 Tryp_SPc 167..410 CDD:238113 87/250 (35%)
Tryp_SPc 167..407 CDD:214473 85/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BM7R
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.