DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CLIPB12

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_319994.4 Gene:CLIPB12 / 1280175 VectorBaseID:AGAP009217 Length:341 Species:Anopheles gambiae


Alignment Length:359 Identity:72/359 - (20%)
Similarity:111/359 - (30%) Gaps:107/359 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CVPQGLCKTSAWNQNAISWPSP---------CQRSES---------CCHSSQKLVIGAP------ 68
            |:|...|.....|..| :|...         |:|..:         ||...      ||      
Mosquito    30 CIPIEQCPLFGSNSRA-TWTEATMNQFRARVCEREPTIDGWTKYKVCCEPP------APSEPRDG 87

  Fly    69 ----------LNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITA 123
                      ..||.:..:    :.|.|.:.....:.||...|..:...:..||||:::..|:|.
Mosquito    88 RKPGLDLLDLKGCGMNRMH----SNESVENNGTLGKLPWIALLKTSSGEYHCAGTLISKRYVLTT 148

  Fly   124 AHLMLDKTINDFGIIGGAWDLKQLAGKTIQWRTA----------TRIVSHPDFNKMTGANNIALI 178
            |..::.|.:          ...||..|....|.|          .|.:.|...||....|||.|:
Mosquito   149 AFCIISKNL----------AFVQLRKKDCDERGACTLKPQDIPIERTIGHDSSNKPWLFNNIGLV 203

  Fly   179 VLETSFVMKPPIGPICWPTSGVSFDRERCLVAGWGRPDFLAKNYSY--KQKKID----------- 230
            .|.........:.|||.|..                |::...:..|  ..:|.|           
Mosquito   204 RLARDASFNSDVRPICLPMG----------------PEYQTTDTKYFIVTRKEDYALLDTDAVAI 252

  Fly   231 --LPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPI-PGHPAIYELV 292
              :.:|:...|:|.|:||  |.:.|     :||......|.|....|:.|.... .|...:|   
Mosquito   253 SEVHLVANEYCQSWLQRT--VHNSQ-----MCAIELAPNDDCAKPYGASLTAQARNGRHVMY--- 307

  Fly   293 GIVNSGFSCGLENVPALYTNISHMRPWIEKQLND 326
            |....|.....:|...:||.:.....||...:.:
Mosquito   308 GAHAFGMDICTQNESTVYTRVESFVDWILSNIEE 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 56/260 (22%)
Tryp_SPc 90..320 CDD:214473 54/255 (21%)
CLIPB12XP_319994.4 Tryp_SPc 118..338 CDD:304450 56/255 (22%)
Tryp_SPc 118..335 CDD:214473 54/252 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.