DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP010730

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_311444.4 Gene:AgaP_AGAP010730 / 1272531 VectorBaseID:AGAP010730 Length:256 Species:Anopheles gambiae


Alignment Length:255 Identity:83/255 - (32%)
Similarity:119/255 - (46%) Gaps:25/255 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 EFPWTVALM------QNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLK------- 145
            |:||.|.::      .|..:|...|||:...:|:|.||....||  |.....|.||:.       
Mosquito     7 EYPWVVYILALKKQEANSGDFVCGGTLIHSRLVVTTAHNTDGKT--DLVARFGEWDISTTKEPFP 69

  Fly   146 QLAGKTIQWRTATRIVSHPD--FNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCL 208
            |......|......::.||.  ||.:  .|:|||:||..:......|.|||.|.....|..:||:
Mosquito    70 QQCLFPHQDIDVAEVIKHPQYVFNPI--QNDIALLVLAENVQYAAHIRPICLPQPTDEFVGQRCV 132

  Fly   209 VAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGD 273
            ..|||:...:   |:...||:.||::.|::|..:||.......:.|....||||||...|.|.||
Mosquito   133 SNGWGKERGV---YANVMKKLTLPVIGRANCTRMLRYAGLGPFYTLREGFLCAGGEVAVDMCKGD 194

  Fly   274 GGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLNDE-LNKPY 332
            |||||.|..  ....|.|.|||:.|..||..|.|.:|..::....|:.:.:.|: ||:.:
Mosquito   195 GGSPLACQT--ESGTYVLAGIVSWGIGCGGFNTPGVYVAVNRYVQWLNEHIVDQALNESF 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 80/243 (33%)
Tryp_SPc 90..320 CDD:214473 79/240 (33%)
AgaP_AGAP010730XP_311444.4 Tryp_SPc 7..242 CDD:238113 80/243 (33%)
Tryp_SPc 7..238 CDD:214473 79/239 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D23222at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.880

Return to query results.
Submit another query.