DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP010661

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_311381.4 Gene:AgaP_AGAP010661 / 1272469 VectorBaseID:AGAP010661 Length:175 Species:Anopheles gambiae


Alignment Length:137 Identity:38/137 - (27%)
Similarity:59/137 - (43%) Gaps:13/137 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 GKTIQWR-----TATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRERCL 208
            |.|.|.|     .|::||.||.:|..|...:.|::.::|||.....|.||....:.|..| ..|.
Mosquito     6 GSTTQTRGGVIFQASKIVIHPYYNPETHDYDAAIVEIKTSFQGYDNIAPIALQDAEVPSD-TTCY 69

  Fly   209 VAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGD 273
            .||||..::..:......:...|.::::..|.:.....|       .|.::||......|.|.||
Mosquito    70 AAGWGLNNYDRRTTPDNLQYATLQVITQQQCSAAWGSYA-------TPQVICAQQNNNGDVCKGD 127

  Fly   274 GGSPLMC 280
            .|.|.:|
Mosquito   128 SGGPFVC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 38/137 (28%)
Tryp_SPc 90..320 CDD:214473 38/137 (28%)
AgaP_AGAP010661XP_311381.4 Tryp_SPc <1..172 CDD:238113 38/137 (28%)
Tryp_SPc <1..162 CDD:214473 38/137 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.