DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and CLIPB7

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_307910.4 Gene:CLIPB7 / 1269288 VectorBaseID:AGAP002270 Length:401 Species:Anopheles gambiae


Alignment Length:412 Identity:91/412 - (22%)
Similarity:153/412 - (37%) Gaps:105/412 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRRVI--FIRCC---------FWTLTET----GAP--CGLQMEC-VPQGLCKTSAWNQNAISWP 47
            :||.::  ||..|         :.:..:|    |.|  |.|..|| ..:.|......:.|.|.:.
Mosquito     5 IWRILVLCFIASCSQLPVTVAQYLSSCKTPGGDGEPGTCVLVRECPFARALLMKQKHSNNDIRYL 69

  Fly    48 SP--CQRSES----CCHSSQKLVIGAPLNCGKSNPNGL--GGTVEEVVDQ--AKPNE-------- 94
            ..  |...|:    ||::..   |.|..:...::.:||  |.|::.:|:.  :.|.|        
Mosquito    70 EAIRCGMLETKALVCCNAPN---ITADSSSSSASIDGLVDGETIDGLVENRFSTPEEKRGLLPEV 131

  Fly    95 -------------------FPWTVALMQNLINFFG------AGTLVTENIVITAAHLM--LDKTI 132
                               |||.|.:.....:  |      .|:|:::..|:|||..:  :.||.
Mosquito   132 CGVDTYRGPIRGELAQLFHFPWNVLIQHRTKD--GEHRCHCGGSLISDRYVLTAARCIMGIKKTW 194

  Fly   133 NDFGIIGGAWDLK-------QLAGKTIQWRTATRIVSHPDFNKMTGANN------------IALI 178
            ....:..|..:|:       ..||.|   ..|:.:...| ..|:|..:|            |||:
Mosquito   195 TIVSVRVGELNLQTDPDCDDSTAGVT---ECASPVEDIP-IEKITVPSNYTGTGSPAVKQDIALL 255

  Fly   179 VLETSFVMKPPIGPICWPTS-----GVSFDRERCLV-AGWGRPDFLAKNYSYKQKKIDLPIVSRS 237
            .|.........:.|||.|.:     |.|.:::.... :|||:....|.....|...:.:. |:|.
Mosquito   256 RLARRVEFSESVAPICLPLNTSNWVGYSTEQDGSFYESGWGKTPDAAAGGDNKWNYVSVG-VARE 319

  Fly   238 DCESLLRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCG 302
            .|.......:      :|...:||.....::.|.||.|.|||.. .|....:.|:|:.:....|.
Mosquito   320 VCRDRYPHAS------IDGEQICAMPRSEQNTCRGDTGGPLMYQ-SGTDGAWYLMGVGSFRKQCA 377

  Fly   303 LENVPALYTNISHMRPWIEKQL 324
            :...||:|||::....||.:.|
Mosquito   378 IVGEPAVYTNVATFTDWIVENL 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 64/296 (22%)
Tryp_SPc 90..320 CDD:214473 62/289 (21%)
CLIPB7XP_307910.4 CLIP 31..85 CDD:288855 12/53 (23%)
Tryp_SPc 151..398 CDD:238113 62/260 (24%)
Tryp_SPc 151..395 CDD:214473 60/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.