DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and AgaP_AGAP010635

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_307830.4 Gene:AgaP_AGAP010635 / 1269219 VectorBaseID:AGAP010635 Length:569 Species:Anopheles gambiae


Alignment Length:339 Identity:72/339 - (21%)
Similarity:119/339 - (35%) Gaps:99/339 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PNEFPWTVALMQNLIN-----FFGAGTLVTENIVITAAHLMLDKT------INDFGIIGGAWDLK 145
            |.::||..||.....|     :....|:|...:||||||.:...|      .::..:..|.::|.
Mosquito    56 PGDWPWHAALYHRGFNSRDFEYACGSTIVHRYLVITAAHCVTFATSRRKIPSDNMQLRLGRFNLM 120

  Fly   146 QLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFD-----RE 205
            ....:..:..:....:.|..:...|..|:||::.:|...:....|.|:|.......||     .:
Mosquito   121 NNEEEYAEEFSVIDTIVHEGYRPTTLENDIAILRVEIPIIFNDYIQPVCLWKRDDGFDLPNVYNQ 185

  Fly   206 RCLVAGWGRPDFLAKN--YSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGERGRD 268
            ...|.|||    |::|  ......:..:|:|:...|  |....||...| |.....|||.:.|..
Mosquito   186 PGTVVGWG----LSENNRIGTTLNEAQMPVVNSWTC--LASDRAFFGRF-LQSKAFCAGYKNGTG 243

  Fly   269 ACIGDGGSPLM------------------------C----------------------------- 280
            .|.||.|..:.                        |                             
Mosquito   244 VCNGDSGGGMFFQFQNRWYLKGIVSFSSVNDYSGWCNLRQYIGFTDASQYIDWVYENTPTSGNDD 308

  Fly   281 PIPGHPAIYELVGIVNSGFSCGL-ENVPALYTN---ISHMRPW---IEKQLNDE--------LNK 330
            ||.|||.    :.::|.| :||. |::|.:..:   |.:..||   ::.:...|        ||:
Mosquito   309 PILGHPN----MRLINQG-NCGRNEHMPEMDEDRKPILNQYPWMVALQAKTTTEYVPCNGVLLNR 368

  Fly   331 PY-KTFPIYNISYD 343
            .| .|...|::.|:
Mosquito   369 NYVLTAECYDLQYE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 65/308 (21%)
Tryp_SPc 90..320 CDD:214473 65/305 (21%)
AgaP_AGAP010635XP_307830.4 Tryp_SPc 50..300 CDD:238113 51/250 (20%)
Tryp_SPc 50..297 CDD:214473 51/247 (21%)
Tryp_SPc 342..563 CDD:214473 9/41 (22%)
Tryp_SPc 342..563 CDD:304450 9/41 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.