DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss29

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_444490.2 Gene:Prss29 / 114662 MGIID:2149952 Length:279 Species:Mus musculus


Alignment Length:285 Identity:77/285 - (27%)
Similarity:135/285 - (47%) Gaps:49/285 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VIGAPLNCGKSNPNG-----LGGTVEEVVDQAKPNEFPWTVALMQNLINFFGA-------GTLVT 116
            :.|.|    ...|.|     :||      ..|...::||.|:|  .:..::.|       |:::.
Mouse    16 IAGTP----APGPEGVLMGIVGG------HSAPQGKWPWQVSL--RIYRYYWAFWVHNCGGSIIH 68

  Fly   117 ENIVITAAHLMLDKTIND--FGI-IGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALI 178
            ...|:||||.:.::..:.  |.| :|.|:   ...||.:  .:.:|::.||||......:::||:
Mouse    69 PQWVLTAAHCIRERDADPSVFRIRVGEAY---LYGGKEL--LSVSRVIIHPDFVHAGLGSDVALL 128

  Fly   179 VLETSFVMKPPIGPICWPTSGVSF-DRERCLVAGWGRPDFLAKNYS----YKQKKIDLPIVSRSD 238
            .|..|....|.:.|:..|:..:.. .::.|.|.|||.   ::.:.|    |:.:::.:.|:..|.
Mouse   129 QLAVSVQSFPNVKPVKLPSESLEVTKKDVCWVTGWGA---VSTHRSLPPPYRLQQVQVKIIDNSL 190

  Fly   239 CESL----LRRTAFVQSFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGF 299
            ||.:    .|.....|...| ..:||||.: |:|:|.||.|.||:|.:.|.   :.|||:|:.|:
Mouse   191 CEEMYHNATRHRNRGQKLIL-KDMLCAGNQ-GQDSCYGDSGGPLVCNVTGS---WTLVGVVSWGY 250

  Fly   300 SCGLENVPALYTNISHMRPWIEKQL 324
            .|.|.:.|.:|..:....|||.:|:
Mouse   251 GCALRDFPGVYARVQSFLPWITQQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 70/253 (28%)
Tryp_SPc 90..320 CDD:214473 68/248 (27%)
Prss29NP_444490.2 Tryp_SPc 31..274 CDD:238113 72/263 (27%)
Tryp_SPc 31..271 CDD:214473 70/260 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842931
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.