DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss28

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_444489.2 Gene:Prss28 / 114661 MGIID:2149951 Length:274 Species:Mus musculus


Alignment Length:286 Identity:69/286 - (24%)
Similarity:134/286 - (46%) Gaps:38/286 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SCCHSSQKLVIGAPLNCGKSNPNGL-GGTVEEVVDQAKPNEFPWTVAL------MQNLINFFGAG 112
            ||..|:   |..|.::..:|.|.|: ||..      ..|.::||.|:|      :.:.::..| |
Mouse    10 SCLEST---VFMASVSISRSKPVGIVGGQC------TPPGKWPWQVSLRMYSYEVNSWVHICG-G 64

  Fly   113 TLVTENIVITAAHLMLDKTIND--FGI-IGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANN 174
            :::....::||||.:..:..:.  :.: :|..:..|:.     :....:||:.|||:|.::...:
Mouse    65 SIIHPQWILTAAHCIQSQDADPAVYRVQVGEVYLYKEQ-----ELLNISRIIIHPDYNDVSKRFD 124

  Fly   175 IALIVLETSFVMKPPIGPICWPTSGVSFD-RERCLVAGWGRPDFLAK---NYSYKQKKIDLPIVS 235
            :||:.|....|....:.|:..|....:|| .::|.:.|||  :.|.:   ...|:..::.:||..
Mouse   125 LALMQLTALLVTSTNVSPVSLPKDSSTFDSTDQCWLVGWG--NLLQRVPLQPPYQLHEVKIPIQD 187

  Fly   236 RSDCESLLRRTAFVQ--SFQLDPTILCAGGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSG 298
            ...|:...|:.:..:  :..:...:||| |..||..|.||.|.||:|   .....:..||:|:.|
Mouse   188 NKSCKRAYRKKSSDEHKAVAIFDDMLCA-GTSGRGPCFGDSGGPLVC---WKSNKWIQVGVVSKG 248

  Fly   299 FSCGLENVPALYTNISHMRPWIEKQL 324
            ..|. .|:|::::.:.....||.:.:
Mouse   249 IDCS-NNLPSIFSRVQSSLAWIHQHI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 59/249 (24%)
Tryp_SPc 90..320 CDD:214473 57/244 (23%)
Prss28NP_444489.2 Tryp_SPc 31..272 CDD:238113 61/259 (24%)
Tryp_SPc 31..269 CDD:214473 59/256 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842932
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.