DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and F11

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_082342.1 Gene:F11 / 109821 MGIID:99481 Length:624 Species:Mus musculus


Alignment Length:327 Identity:84/327 - (25%)
Similarity:130/327 - (39%) Gaps:74/327 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CFWTLTETGAP----------CGLQME-CVPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLV 64
            |:..|:..|:|          .|..:. |....:|.|                            
Mouse   348 CYLKLSSNGSPTRILHGRGGISGYSLRLCKMDNVCTT---------------------------- 384

  Fly    65 IGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLD 129
                    |.||..:||..      :...|:||.|.|..:..:..| |:::....::||||....
Mouse   385 --------KINPRVVGGAA------SVHGEWPWQVTLHISQGHLCG-GSIIGNQWILTAAHCFSG 434

  Fly   130 -KTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPI 193
             :|.....:.||..:..::...|..:|....|: |..:.......:|||:.||::........||
Mouse   435 IETPKKLRVYGGIVNQSEINEGTAFFRVQEMII-HDQYTTAESGYDIALLKLESAMNYTDFQRPI 498

  Fly   194 CWPTSGVSFDRE----RCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQL 254
            |.|:.|   ||.    .|.|.|||......:..|..| |..:|:||..:|::..||      .::
Mouse   499 CLPSKG---DRNAVHTECWVTGWGYTALRGEVQSTLQ-KAKVPLVSNEECQTRYRR------HKI 553

  Fly   255 DPTILCAG-GERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRP 318
            ...::||| .|.|:|.|.||.|.||.|...|   ::.||||.:.|..||.:..|.:|||::....
Mouse   554 TNKMICAGYKEGGKDTCKGDSGGPLSCKYNG---VWHLVGITSWGEGCGQKERPGVYTNVAKYVD 615

  Fly   319 WI 320
            ||
Mouse   616 WI 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 71/239 (30%)
Tryp_SPc 90..320 CDD:214473 69/235 (29%)
F11NP_082342.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..376 CDD:128519 5/27 (19%)
Tryp_SPc 389..617 CDD:214473 71/248 (29%)
Tryp_SPc 390..617 CDD:238113 71/247 (29%)
Heparin-binding. /evidence=ECO:0000250 547..550 0/2 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.