DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and LOC108647852

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_017950296.2 Gene:LOC108647852 / 108647852 -ID:- Length:416 Species:Xenopus tropicalis


Alignment Length:267 Identity:82/267 - (30%)
Similarity:126/267 - (47%) Gaps:25/267 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VEEVVD--QAKPNEFPWTVALMQNLINFFGA---GTLVTENIVITAAHLMLD-KTINDFG-IIGG 140
            |..|::  ..:|..:||..::.....:.:|:   |.|::...|:||||.:.| |...... |:.|
 Frog    41 VRRVIEGNTPEPGSWPWMASIQLLYKDGYGSACGGVLLSNRWVVTAAHCLSDLKRYRHLARIVLG 105

  Fly   141 AWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWP--TSGVSFD 203
            |.||.||..:| |.||..:.:.|.||:..|..|:||||.|.........|.|.|.|  :|.| :.
 Frog   106 ARDLTQLGPET-QIRTIKQWIQHEDFDHKTHKNDIALIRLNYPVKFSDYIQPACLPPKSSNV-YK 168

  Fly   204 RERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGER-GR 267
            .:.|.:||||..:...:..:...::..:.::.|..|.|     :...:..:....||||.|: |.
 Frog   169 MDDCHIAGWGLLNEKPRTVTTMLQEATVELIDRKRCNS-----SDWYNGGIHDDNLCAGYEQGGP 228

  Fly   268 DACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLNDELNKPY 332
            |.|:||.|.||||. .....||.:||||:.|..||..:...:||::.....||       .||..
 Frog   229 DVCMGDSGGPLMCK-RKKAGIYYVVGIVSWGGLCGQPHSNGVYTSVQDFEQWI-------FNKTS 285

  Fly   333 KTFPIYN 339
            .:.|.|:
 Frog   286 SSNPKYH 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 76/244 (31%)
Tryp_SPc 90..320 CDD:214473 74/237 (31%)
LOC108647852XP_017950296.2 Tryp_SPc 44..280 CDD:238113 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.