DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Prss48

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_017446782.1 Gene:Prss48 / 108350052 RGDID:11436036 Length:308 Species:Rattus norvegicus


Alignment Length:272 Identity:77/272 - (28%)
Similarity:127/272 - (46%) Gaps:45/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VIGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLML 128
            |.|.|:..|:.    :||      ..|....:||.|:|..:..:..| |:|::.:.|:|||| .:
  Rat    30 VCGRPVYSGRI----VGG------QGAALGHWPWQVSLRFDSTHICG-GSLISNHWVMTAAH-CI 82

  Fly   129 DKTINDFGIIGGAW--DLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIG 191
            .||.  |..:...|  .:.:....|.:....:|||.....:...|  :|||:.|.:.......:.
  Rat    83 KKTW--FSFLYSVWLGSIDRDYSSTGEEYYVSRIVIPSKHHNTDG--DIALLKLSSRVTFTSLVL 143

  Fly   192 PICWP------TSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQ 250
            |||.|      |...|     |.|.|||:..  ..:|....:::::||::...||.|.....|  
  Rat   144 PICLPNISKPLTVPAS-----CWVTGWGQNQ--EGHYPSTLQELEVPIITGEACEQLYNPIGF-- 199

  Fly   251 SFQLD------PTILCAGG-ERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPA 308
             |..|      ..:||||. ::.:|:|.||.|.||.|.|.|   ::..:|:::.|..|| :|:|.
  Rat   200 -FLPDLERIIKEDMLCAGEIQQSKDSCKGDSGGPLSCHIDG---VWTQIGVISWGLECG-KNLPG 259

  Fly   309 LYTNISHMRPWI 320
            :|||:::.:.||
  Rat   260 VYTNVTYYQKWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 71/248 (29%)
Tryp_SPc 90..320 CDD:214473 69/244 (28%)
Prss48XP_017446782.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.