DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and si:dkey-32n7.7

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_021335883.1 Gene:si:dkey-32n7.7 / 108191692 ZFINID:ZDB-GENE-121214-179 Length:609 Species:Danio rerio


Alignment Length:290 Identity:68/290 - (23%)
Similarity:119/290 - (41%) Gaps:56/290 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 SCCH-SSQKLVIGAPLNCGKSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLINFFG---AGTLV 115
            ||.: :||.|...:...||....|...|||..  ..:....:||..:|..    :.|   .|:|:
Zfish   280 SCINTNSQALDSPSAAVCGIIPVNSSNGTVGG--QNSSAVHWPWQASLYW----YSGQTCGGSLI 338

  Fly   116 TENIVITAAH-------------LMLDKTINDFGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFN 167
            .:..|::|||             ::..||.|.:       |..:::      |:...::.||.:|
Zfish   339 NKEWVLSAAHCFNGQRNGFYLTVILGPKTQNKY-------DPSRIS------RSVKAVIKHPYYN 390

  Fly   168 KMTGANNIALIVLETSFVMKPPIGPICWPTSGVSFDRE-RCLVAGW-----GRPDFLAKNYSYKQ 226
            ..|..|:|||:.|.........|.|:|....|..|:.: ...:..|     |.|....|.:    
Zfish   391 PNTNDNDIALVRLSFPITFTDSIRPVCLAAEGSVFNSDTESWITTWRNISDGVPLPSPKIF---- 451

  Fly   227 KKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG-GERGRDACIGDGGSPLMCPIPGHPAIYE 290
            :::::|::....|..|....:...:      ::||| .:.|:|.|.||.|.|:   :....:::.
Zfish   452 QEVEVPVIGNRQCNCLYGVGSITDN------MICAGLLKEGKDLCQGDSGGPM---VSNQSSVWV 507

  Fly   291 LVGIVNSGFSCGLENVPALYTNISHMRPWI 320
            ..|||:.|..|.....|.:||.:|..:.||
Zfish   508 QSGIVSFGSGCAQSEFPGVYTRVSRYQEWI 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 57/256 (22%)
Tryp_SPc 90..320 CDD:214473 55/252 (22%)
si:dkey-32n7.7XP_021335883.1 NIDO 4..63 CDD:310601
NIDO 141..272 CDD:322035
Tryp_SPc 309..537 CDD:238113 56/259 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587639
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.