DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and MASP2

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_006601.2 Gene:MASP2 / 10747 HGNCID:6902 Length:686 Species:Homo sapiens


Alignment Length:247 Identity:78/247 - (31%)
Similarity:120/247 - (48%) Gaps:20/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 QAKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDLKQLAGKTIQ 153
            :|||.:|||.|.::....   .||.|:.:|.|:||||.:.::..:...:......||:|:....|
Human   450 KAKPGDFPWQVLILGGTT---AAGALLYDNWVLTAAHAVYEQKHDASALDIRMGTLKRLSPHYTQ 511

  Fly   154 -WRTATRIVSHPDFNKMTG-ANNIALIVLETSFVMKPPIGPICWP-TSGVSFDRERCL--VAGWG 213
             |..|..|  |..:....| .|:||||.|....|:...|.|||.| ....||.|...:  .:|||
Human   512 AWSEAVFI--HEGYTHDAGFDNDIALIKLNNKVVINSNITPICLPRKEAESFMRTDDIGTASGWG 574

  Fly   214 --RPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGGER-GRDACIGDGG 275
              :..|||:|..|    :|:|||....|.:...:..:.:. .:...:||||.|. |:|:|.||.|
Human   575 LTQRGFLARNLMY----VDIPIVDHQKCTAAYEKPPYPRG-SVTANMLCAGLESGGKDSCRGDSG 634

  Fly   276 SPLMCPIPGHPAIYELVGIVNSG-FSCGLENVPALYTNISHMRPWIEKQLND 326
            ..|:. :......:.:.|||:.| .:||......:||.:.:..||||..::|
Human   635 GALVF-LDSETERWFVGGIVSWGSMNCGEAGQYGVYTKVINYIPWIENIISD 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 77/242 (32%)
Tryp_SPc 90..320 CDD:214473 74/238 (31%)
MASP2NP_006601.2 CUB 28..134 CDD:214483
EGF_CA 138..176 CDD:214542
CUB 184..293 CDD:278839
CCP 300..361 CDD:214478
Sushi 366..430 CDD:278512
Tryp_SPc 444..679 CDD:214473 74/239 (31%)
Tryp_SPc 445..682 CDD:238113 77/242 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.