DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and LOC101732176

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_031752403.1 Gene:LOC101732176 / 101732176 -ID:- Length:516 Species:Xenopus tropicalis


Alignment Length:288 Identity:83/288 - (28%)
Similarity:138/288 - (47%) Gaps:39/288 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 QRSESCCHSSQKLVIGAPLNCG---KSNPNGLGGTVEEVVDQAKPNEFPWTVALMQNLIN---FF 109
            |.|.:|  ::..:|....:|||   |.:...:|||.      |...::||.::||: |:.   :.
 Frog   249 QYSATC--TTGTMVSLRCINCGLSTKVDNRIVGGTF------ALAGDWPWQISLMK-LVGTSLYL 304

  Fly   110 GAGTLVTENIVITAAHLMLDKTIND--FGIIGGAWDLKQL--AGKTIQWRTATRIVSHPDFNKMT 170
            ..|:::|...::||||.:...|.:.  |.:..|:..|...  ||..:.     |::.||.::..|
 Frog   305 CGGSIITPYWIVTAAHCVYGYTSSPSIFKVFAGSLTLSNYYSAGYLVD-----RVLIHPSYSPNT 364

  Fly   171 GANNIALIVLETSFVMKPPIGPICWPTSGVSF-DRERCLVAGWGRPDFLAKNYSYKQKKIDLPIV 234
            ...:|||:.|:|:.|....:.|:|.|..|:.: |.:.|.::|||... .|.:.|...|...:||:
 Frog   365 QNYDIALLKLKTALVFSTNLRPVCLPNVGMPWADGQPCWISGWGTTS-EAGSISTSLKAASVPII 428

  Fly   235 SRSDCESLLRRTAFVQSFQLDPTILCA---GGERGRDACIGDGGSPLMCPIPGHPAIYELVGIVN 296
            |.:.|     ..|.|....:.||::||   ||  |.|.|.||.|.||   :....:::.|||..:
 Frog   429 SSATC-----NLAPVYGGVISPTMICAGYLGG--GTDTCQGDSGGPL---VTKTNSLWWLVGDTS 483

  Fly   297 SGFSCGLENVPALYTNISHMRPWIEKQL 324
            .|:.|.....|.:|.||:....||..|:
 Frog   484 WGYGCARAYKPGVYGNITVFLEWIYSQM 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 71/245 (29%)
Tryp_SPc 90..320 CDD:214473 69/240 (29%)
LOC101732176XP_031752403.1 LDLa <115..133 CDD:238060
LDLa 140..171 CDD:238060
SRCR_2 176..271 CDD:406055 7/23 (30%)
Tryp_SPc 277..510 CDD:238113 74/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.