DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and prss56

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_017949880.1 Gene:prss56 / 101731690 XenbaseID:XB-GENE-6051085 Length:665 Species:Xenopus tropicalis


Alignment Length:294 Identity:89/294 - (30%)
Similarity:131/294 - (44%) Gaps:71/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GAPLNCGK--------SNPNG--LGGTVEEVVDQAKPNEFPWTVALMQNLINFFG----AGTLVT 116
            |:|:.||:        :.|.|  :||::      ..|..:||.|.     |.|.|    .|.|:.
 Frog    53 GSPVTCGQKFSSISNNTGPKGRIVGGSI------TSPGSWPWLVN-----IRFNGELMCGGVLLD 106

  Fly   117 ENIVITAAHLMLDKTIND--FGIIGGAWDL-KQLAG-KTIQWRTATRIVSHPDFNKMTGANNIAL 177
            :..::||||.... ::|:  :.::.|.:|| |...| ||.|   ..|||:||.||:.|..|::||
 Frog   107 DMWILTAAHCFTG-SVNEVLWTVVVGQYDLTKNAQGEKTFQ---VNRIVTHPKFNQKTFDNDLAL 167

  Fly   178 IVLETSFVMKPPIGPICW------PTSGVSFDRERCLVAGWGRPDFLAKNYSYKQKKID------ 230
            :.|.:|........|:|.      ||.|.:     |.:||||.        .|:...:.      
 Frog   168 LELTSSVTASQSARPVCLPPVPRDPTPGTN-----CYIAGWGS--------LYEDGPLSDVIMEA 219

  Fly   231 -LPIVSRSDCESLLRRTAFVQSFQLDPTILCAGG-ERGRDACIGDGGSPLMC--PIPGHPAIYEL 291
             :|::|:..|.|.|.:.      .|..|:.|||. ..|.|:|.||.|.||.|  ||...   |.|
 Frog   220 RVPVLSQEACRSTLGKN------MLTSTMFCAGYLNGGIDSCQGDSGGPLTCQDPISKQ---YVL 275

  Fly   292 VGIVNSGFSCGLENVPALYTNISHMRPWIEKQLN 325
            .||.:.|..||....|.:||.::....||..|:|
 Frog   276 YGITSWGDGCGERGKPGVYTRVTAFTDWISHQMN 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 79/258 (31%)
Tryp_SPc 90..320 CDD:214473 77/253 (30%)
prss56XP_017949880.1 Tryp_SPc 75..305 CDD:238113 80/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.