DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and cela1.2

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:259 Identity:65/259 - (25%)
Similarity:118/259 - (45%) Gaps:30/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LGGTVEEVVDQAKPNEFPWTVALMQNLIN---FFGAGTLVTENIVITAAHLMLDKTINDFGIIGG 140
            :||.:      |||:.:||.::|..:.:.   ::.:|||:....|:.|||.:  :.:..:.:..|
Zfish    31 VGGEI------AKPHSWPWQISLQYSDLGTYYYYCSGTLIRPGWVMVAAHCV--EALRKWTVALG 87

  Fly   141 AWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANN------IALIVLETSFVMKPPIGPICWPTSG 199
            ..|:....|.. |:.:.:.:..||::|    .||      |||:.|.....:...:.....|:||
Zfish    88 DHDIYTHEGPE-QYISVSEVFIHPNWN----PNNVAFGYDIALLRLSIDATLSSYVQVATLPSSG 147

  Fly   200 VSFD-RERCLVAGWGRPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGG 263
            .... ...|.:.|||..: ...:.|.:.|:..:|:|   |.|:..::..:..|  :..|::||||
Zfish   148 EILPYGHTCYITGWGYTE-TGGSLSAQLKQAYMPVV---DYETCSQKDWWGSS--VKETMICAGG 206

  Fly   264 ERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLNDE 327
            .....||.||.||||.|...|...::.:...| |...|.....|..:|.:|....||.:.::::
Zfish   207 TTSMSACHGDSGSPLNCLFNGKYVVHGVTSFV-SPEGCNTYKKPTGFTRVSAYINWINQIISEK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 63/244 (26%)
Tryp_SPc 90..320 CDD:214473 61/239 (26%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 63/250 (25%)
Tryp_SPc 30..265 CDD:238113 65/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.