DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and tmprss6

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_004913946.2 Gene:tmprss6 / 100489045 XenbaseID:XB-GENE-1011573 Length:806 Species:Xenopus tropicalis


Alignment Length:385 Identity:98/385 - (25%)
Similarity:151/385 - (39%) Gaps:119/385 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IRCCFWTLTETGAPCGLQMECVPQGLCKTSAWNQNAISWPSPCQRSESCCHSSQKLVIGAPLN-- 70
            ::.|...|.|....|..|..|.....|         ||..|.|...:.|.:.:.:.:.....|  
 Frog   466 VKDCPNELDERNCVCPAQYHCPGAESC---------ISITSVCDGKKDCANGTDEELCNQGANFP 521

  Fly    71 ---CGKSN----------------------PNG-----------------LGGTVEEVVDQAKPN 93
               ||..|                      |:|                 :|||      ||:..
 Frog   522 TAACGAFNYKCADGSCVQKPNAECDSIADCPDGSDENNCGCGIQAVGIRLVGGT------QAQEG 580

  Fly    94 EFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAWDL------------KQ 146
            |:||..:|.....:..| ||||.:..::||||....::.....:    |.:            |:
 Frog   581 EWPWQASLQVRGEHICG-GTLVADQWILTAAHCFTPESYASPEV----WTVYLGKVRLSRSTQKE 640

  Fly   147 LAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLE-----TSFVMKPPIGPICWPTSGVSFDR-E 205
            ||.|.|      |:|.||.:::.:...::||::|:     ||    |.:.|||.|:|...|.. .
 Frog   641 LAFKVI------RLVIHPFYDEDSHDYDVALVLLDHLVPLTS----PHVQPICLPSSTHHFPTGS 695

  Fly   206 RCLVAGWGRPDFLAKNYSYKQ--------KKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAG 262
            .|.|.|||         |.|:        :|:|:.:|::..|..|.|       :|:.|.:||||
 Frog   696 SCWVTGWG---------SVKENGPTSDVLQKVDIQLVAQDICTELYR-------YQISPRMLCAG 744

  Fly   263 GERG-RDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIE 321
            ...| :|||.||.||||:|....  ..:...|:|:.|..||:.....:|:.|:.:..|||
 Frog   745 YRDGSKDACQGDSGSPLVCKTAS--GRWFQAGLVSWGAGCGIPRYFGVYSRITRLVQWIE 802

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 77/261 (30%)
Tryp_SPc 90..320 CDD:214473 73/256 (29%)
tmprss6XP_004913946.2 SEA 77..176 CDD:396113
CUB 235..303 CDD:412131
LDLa 448..478 CDD:238060 3/11 (27%)
LDLa 480..514 CDD:238060 9/42 (21%)
LDLa 525..560 CDD:238060 5/34 (15%)
Tryp_SPc 572..804 CDD:238113 80/270 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.