DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and Gm10334

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001096623.1 Gene:Gm10334 / 100040233 MGIID:3641889 Length:246 Species:Mus musculus


Alignment Length:263 Identity:75/263 - (28%)
Similarity:124/263 - (47%) Gaps:52/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 LGGTVEEVVDQ---------AKPNEFPWTVALMQNLINFFGAGTLVTENIVITAAHLMLDKTIND 134
            :|..|...||.         .:.|..|:.|:|  |....|..|:|:.:..|::|||..  ||...
Mouse    10 VGAAVAFPVDDDDKIVGGYTCQENSVPYQVSL--NSGYHFCGGSLINDQWVVSAAHCY--KTRIQ 70

  Fly   135 FGIIGGAWDLKQLAGKTIQWRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSG 199
            ..:  |..::..|.|.. |:..|.:|:.||:||:.|..|:|.||.|.:...:...:..:..|:|.
Mouse    71 VRL--GEHNINVLEGNE-QFVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTLNARVATVALPSSC 132

  Fly   200 VSFDRERCLVAGWG--------RPDFLAKNYSYKQKKIDLPIVSRSDCESLLRRTAFVQSF--QL 254
            .....: ||::|||        .||.|        :.:|.|::.::|||:         |:  ::
Mouse   133 APAGTQ-CLISGWGNTLSFGVSEPDLL--------QCLDAPLLPQADCEA---------SYPGKI 179

  Fly   255 DPTILCAGG-ERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLENVPALYTNISHMRP 318
            ...::|||. |.|:|:|.||.|.|::|.       .||.|||:.|:.|.|.:.|.:||.:.:...
Mouse   180 TGNMVCAGFLEGGKDSCQGDSGGPVVCN-------GELQGIVSWGYGCALPDNPGVYTKVCNYVD 237

  Fly   319 WIE 321
            ||:
Mouse   238 WIQ 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 72/254 (28%)
Tryp_SPc 90..320 CDD:214473 69/240 (29%)
Gm10334NP_001096623.1 Tryp_SPc 24..242 CDD:238113 71/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.