DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and zgc:163079

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001077051.2 Gene:zgc:163079 / 100006550 ZFINID:ZDB-GENE-030131-7428 Length:313 Species:Danio rerio


Alignment Length:293 Identity:76/293 - (25%)
Similarity:125/293 - (42%) Gaps:63/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 CGKS--NPNGLGGTVEEVVDQAKPNEFPWTVAL-MQNLINFFGAGTLVTENIVITAAHLMLDKTI 132
            ||::  |...:||.      .|....:||..:: ::....|:..|:|:.:..|:|.|.:      
Zfish    27 CGRAPLNTKIIGGL------NATQGSWPWQASINLKATEEFYCGGSLINKGWVLTTAKV------ 79

  Fly   133 NDFGIIGGAWDLKQLAGKTIQ--------WRTATRIVSHPDFNKMTGANNIALIVLETSFVMKPP 189
              |.:: .|.|:....|:..|        .||.|:|:.||::|.:.  :|:||:.|.:.......
Zfish    80 --FALM-PASDIVVYLGRQTQNGSNPYEISRTVTKIIKHPNYNSLD--SNLALLKLSSPVTFSDY 139

  Fly   190 IGPICWPTSGVSF-DRERCLVAGWG------------RPDFLAKNYSYKQKKIDLPIVSRSDCES 241
            |.|:|...:|..| |.....|.|||            .||.|        ::::.|||:..:|.:
Zfish   140 IKPVCLAAAGSVFVDGTASWVTGWGYLNRPATVEEIMLPDVL--------QEVEAPIVNNFECNA 196

  Fly   242 LLRRTAFVQSFQLDPTILCAG--GERGRDACIGDGGSPLMCPIPGHPAIYELVGIVNSGFSCGLE 304
                   .....:...:||||  .|.|:..|.||.|.||:..   ..||:...|:|.||: |||.
Zfish   197 -------AYGGIITNKLLCAGYLNEDGKAPCAGDVGGPLVIK---QGAIWIQSGVVVSGY-CGLP 250

  Fly   305 NVPALYTNISHMRPWIEKQLNDELNKPYKTFPI 337
            ..|.:|..:|....||....|..| ..:.::|:
Zfish   251 GYPTIYVRVSEYEDWISYYTNSSL-PGFVSYPL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 68/258 (26%)
Tryp_SPc 90..320 CDD:214473 66/253 (26%)
zgc:163079NP_001077051.2 Tryp_SPc 35..266 CDD:214473 68/266 (26%)
Tryp_SPc 36..267 CDD:238113 69/266 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.