DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18557 and tmprss3a

DIOPT Version :9

Sequence 1:NP_608721.1 Gene:CG18557 / 33483 FlyBaseID:FBgn0031470 Length:343 Species:Drosophila melanogaster
Sequence 2:XP_021334565.1 Gene:tmprss3a / 100000148 ZFINID:ZDB-GENE-070912-70 Length:543 Species:Danio rerio


Alignment Length:302 Identity:79/302 - (26%)
Similarity:129/302 - (42%) Gaps:40/302 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NAISWPSPCQRSESCCHSSQKLVIGAP-----LNCG---KSNPNGLGGTVEEVVDQAKPNEFPWT 98
            |..|:..|.:.......|..|..:|..     :.||   |.:...:||.:      :...:|||.
Zfish   254 NQTSFQQPVKIHNITNSSKTKCSLGMVTALKCIACGSRPKFSARIVGGNL------SAEGQFPWQ 312

  Fly    99 VAL-MQNLINFFGAGTLVTENIVITAAHLMLDKTINDFGIIGGAW-----DLKQLAGKTIQWRTA 157
            |:| .||  .....|:::|...::||||.:       :||....:     .|.:|....::....
Zfish   313 VSLHFQN--EHLCGGSIITSRWILTAAHCV-------YGIAYPMYWMVYAGLTELPLNAVKAFAV 368

  Fly   158 TRIVSHPDFNKMTGANNIALIVLETSFVMKPPIGPICWPTSGVSF-DRERCLVAGWGRPDFLAKN 221
            .:|:.|..:......::|||:.|.........:.|||.|..|..| |.:.|.::|||..:. ..:
Zfish   369 EKIIYHSRYRPKGLDHDIALMKLAQPLTFNGMVEPICLPNFGEQFEDGKMCWISGWGATED-GGD 432

  Fly   222 YSYKQKKIDLPIVSRSDCESLLRRTAFVQSFQLDPTILCAGG-ERGRDACIGDGGSPLMCPIPGH 285
            .|..|....:|::|...|.    :....|.: |...::|||. :.|.|:|.||.|.||.|.   .
Zfish   433 ASVSQHCASVPLISNKACS----QPEVYQGY-LTAGMICAGYLDGGTDSCQGDSGGPLACE---D 489

  Fly   286 PAIYELVGIVNSGFSCGLENVPALYTNISHMRPWIEKQLNDE 327
            .:|::|||..:.|..|..:|.|.:||.|:....||..|:..|
Zfish   490 SSIWKLVGATSWGQGCAEKNKPGVYTRITQSLTWIHLQMERE 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18557NP_608721.1 Tryp_SPc 88..323 CDD:238113 66/242 (27%)
Tryp_SPc 90..320 CDD:214473 64/237 (27%)
tmprss3aXP_021334565.1 LDLa 154..186 CDD:238060
SRCR_2 191..292 CDD:317845 8/37 (22%)
Tryp_SPc 298..525 CDD:238113 67/250 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.