DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and AT2G26100

DIOPT Version :10

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_180179.2 Gene:AT2G26100 / 817150 AraportID:AT2G26100 Length:371 Species:Arabidopsis thaliana


Alignment Length:158 Identity:43/158 - (27%)
Similarity:67/158 - (42%) Gaps:29/158 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 DKELGS----VALNVREGYSNLWPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAF---- 179
            :||:..    |.|:..|.|..|..||.|..:..:|  ..:.|:::|||||.|...:.|...    
plant   169 EKEIKEYRDFVLLDTEEEYIRLPYKTLAFFKAAFK--LFEADYYVKADDDIYLRPDRLATLLANE 231

  Fly   180 -LHAHNF-----REPVYFGNKFRQHVKEGYMSG--------GAGYVLSKMALHRLIKLGFSNSSI 230
             ||:..:     :.||....|.:.:.|:|.:.|        |..||||...:..|  ....|.|:
plant   232 RLHSQTYIGCMKKGPVITDPKLKWYEKQGNLIGNEYFLHAYGPIYVLSAEIVASL--AAARNGSL 294

  Fly   231 CTNRNYGYEDVELGRCLAGVGVVGGDSR 258
               |.:..|||.:|..:..:.|...|:|
plant   295 ---RMFNNEDVTIGSWMLAMDVHHEDNR 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:473923 31/112 (28%)
AT2G26100NP_180179.2 Galactosyl_T 124..319 CDD:426415 42/156 (27%)

Return to query results.
Submit another query.