DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and b3glctb

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001289177.1 Gene:b3glctb / 564156 ZFINID:ZDB-GENE-091204-128 Length:493 Species:Danio rerio


Alignment Length:224 Identity:60/224 - (26%)
Similarity:94/224 - (41%) Gaps:32/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNLWPKTRAALQY 150
            |...|.|..:.|..|...:|:||.:....|.:.|...|..:.:|.|.|.........||.|.|:.
Zfish   267 VFVAVKTCQRFHRDRVPIVKQTWEKDAASLEYYSDVTDSIIPTVHLGVPNTERGHCEKTFAILRR 331

  Fly   151 VYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHV-KEG--YMSGGAGYVL 212
            .......:..|.|..||||...:..||..|..::..|.|..|.::...: ::|  |::||.|.|.
Zfish   332 FASGAVTQAPWLLIVDDDTLISLPRLRRLLSCYDPTEAVSVGERYGYGLSRDGYSYITGGGGMVF 396

  Fly   213 SKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFSPLHWYPQ 277
            |::|:..::..|.|    |.:.: ..:|:.||.||..:|:.             :..|||....:
Zfish   397 SRVAVQNILAGGCS----CRSSD-APDDMVLGMCLTTLGLP-------------VTHSPLFHQAR 443

  Fly   278 PPDWYQPLLYYTSPDNSSDCCSNTAISFH 306
            |.|:.:.||...||           ||||
Zfish   444 PDDYVKELLARQSP-----------ISFH 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 35/126 (28%)
b3glctbNP_001289177.1 Galactosyl_T <121..>193 CDD:304462
Galactosyl_T 264..465 CDD:304462 60/224 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.