DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and c1galt1c1

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001004886.1 Gene:c1galt1c1 / 448225 XenbaseID:XB-GENE-941230 Length:317 Species:Xenopus tropicalis


Alignment Length:261 Identity:74/261 - (28%)
Similarity:123/261 - (47%) Gaps:36/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LFNETRVLCMVLTSPK-THHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNLWPK 143
            |.:..:|.|::|..|| ..|..|  ::.||.:.|:|..:.|::..|...|::::.    ::||..
 Frog    62 LSHSMQVYCIILVRPKDLSHWAA--VRETWSKHCDKADYYSSEPMKVFESISVDT----NDLWAM 120

  Fly   144 TRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEG---YMS 205
            .|.|:|..|:::...|:||......|:.::|||:.||...:..:|.|.|:.    ||.|   |:.
 Frog   121 MRKAIQMTYENNKNAYNWFFICTPSTFAVIENLKYFLLQKDPSQPYYLGHT----VKSGDLDYVD 181

  Fly   206 GGAGYVLSKMALHRLIKLGFSNSSICTNRNYGY-----EDVELGRCLAGVGVVGGDSRDEQGLSR 265
            ...|.|||..:||||..: |.....|..:. |.     ||.:|..||...||:..::.|.:|.:.
 Frog   182 IAGGIVLSIESLHRLFSI-FKEPEKCPEQG-GLIFKMSEDKQLAMCLKYKGVLAENAEDSEGKNV 244

  Fly   266 FIPFSPLHWYPQPPDWYQPLLYYTSPDNS----SDCCSNTAISFHYNNAQEFYVLEYIIYKLRIF 326
            |...|           ...|:..|..:|.    ..|||:.||:|...:....:|:.|.:|:||.:
 Frog   245 FNTKS-----------VGTLIQETMANNPQKVVEGCCSDMAITFSGISPNFMHVMMYGVYRLRAY 298

  Fly   327 G 327
            |
 Frog   299 G 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 37/127 (29%)
c1galt1c1NP_001004886.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.