DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and CG9109

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster


Alignment Length:286 Identity:78/286 - (27%)
Similarity:118/286 - (41%) Gaps:66/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKAD---KELGSVALNVREGYSNLWPKTRAALQYV 151
            :.|..|.|..|...|:|||........:.|..||   ..:|:...||:.|:.   .||.|.||..
  Fly   278 IKTCAKFHKERIPIIERTWAADARNRRYYSDVADVGIPAIGTGIPNVQTGHC---AKTMAILQLS 339

  Fly   152 YKHHFQKYD--WFLKADDDTYFIME-----------NLRAFLHAHNFREPVYFGNK--FRQHVKE 201
            .|...::.|  |.:..||||...:.           .:.|.|..||..|.||.|.:  :|.|..:
  Fly   340 LKDIGKQLDIRWLMLVDDDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPD 404

  Fly   202 G--YMSGGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLS 264
            |  |.:||||.||| :.|.|||....|    |.:.: ..:|:.||.||..:||..          
  Fly   405 GFNYHTGGAGIVLS-LPLVRLIVQRCS----CPSAS-APDDMILGYCLQALGVPA---------- 453

  Fly   265 RFIPFSPLHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFH--YNNAQEFYVLEYIIYKLRIFG 327
              |..:.:| ..:|.|:...||...:|           ::||  :|...|.      .|:..:.|
  Fly   454 --IHVAGMH-QARPQDYAGELLQLHAP-----------LTFHKFWNTDPEH------TYRRWLGG 498

  Fly   328 --INRELGPLP--KKKASSRPMSINL 349
              :||. .||.  |::.::.|:.:.:
  Fly   499 SMVNRS-APLAAHKEQPAAGPLHMTM 523

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 45/143 (31%)
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 68/240 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.