DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and c1galt1b

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_956345.1 Gene:c1galt1b / 337131 ZFINID:ZDB-GENE-030131-9075 Length:374 Species:Danio rerio


Alignment Length:301 Identity:122/301 - (40%)
Similarity:166/301 - (55%) Gaps:34/301 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LAARLFNETRVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNL 140
            ||..|:...|:||.|:|.|.....:|.|:|.||.|.||.::|:|:..:.:..:|.||.:||...|
Zfish    79 LADSLYKRVRILCWVMTGPDNLEKKARHVKATWSRHCNIVVFISSVDNPDFPTVGLNTKEGRDQL 143

  Fly   141 WPKTRAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMS 205
            :.||..|..||.:.|..:.|||||||||||.|::|||..|..|:..:|||||.:|:.:||:||||
Zfish   144 YWKTIRAFHYVMEKHSDEADWFLKADDDTYVIVDNLRWILARHSPEDPVYFGRRFKPYVKQGYMS 208

  Fly   206 GGAGYVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFS 270
            |||||||||.||.|.:: || .:.:||:.. ..||:.:|:|:..:||..|||||......|.||.
Zfish   209 GGAGYVLSKEALRRFVE-GF-RTKVCTHTT-SVEDLAMGQCMEKIGVKAGDSRDTMQRETFHPFV 270

  Fly   271 P----------LHWYPQPPDW---YQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYK 322
            |          ..||     |   |.|::      ....|||:.|:||||.:|...|:|||..|.
Zfish   271 PESHLTGTFPKTFWY-----WNYCYYPIV------QGPQCCSDLAVSFHYVDASHMYLLEYYTYH 324

  Fly   323 LRIFGIN-RELGPLPKKKASSR------PMSINLQTTKEEN 356
            ||.||.. |...|.|..||..:      .....::..:|||
Zfish   325 LRAFGYKYRYQPPEPNVKAPEKVETRVLEQKDKVEAQEEEN 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 61/123 (50%)
c1galt1bNP_956345.1 Galactosyl_T 107..274 CDD:304462 80/169 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..374 3/11 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579297
Domainoid 1 1.000 173 1.000 Domainoid score I3636
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103571
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.