DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and C1galt1c1

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001025204.1 Gene:C1galt1c1 / 302499 RGDID:1311230 Length:316 Species:Rattus norvegicus


Alignment Length:264 Identity:78/264 - (29%)
Similarity:121/264 - (45%) Gaps:32/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNLWPKTRAALQ 149
            :|.|:||..||.....|. :|.||.:.|:|..|.|::..|...|:.::.    :::|...|.|.:
  Rat    66 QVYCIVLVKPKDVSLWAA-VKETWTKHCDKAEFFSSENVKVFESINMDT----NDMWLMMRKAYK 125

  Fly   150 YVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEG---YMSGGAGYV 211
            |.|..:..:|:||..|...|:.::|||:.||...:..:|.|.|:.    ||.|   |:|...|.|
  Rat   126 YAYDKYKDQYNWFFLARPTTFAVIENLKYFLLRKDPSQPFYLGHT----VKSGDLEYVSVDGGIV 186

  Fly   212 LSKMALHRLIKLGFSNSSICTNRNYGY-----EDVELGRCLAGVGVVGGDSRDEQGLSRFIPFSP 271
            ||..::.||..| .|....|..:. |.     ||.:|..||...||...::.|..|...|...|.
  Rat   187 LSIESMKRLNGL-LSVPEKCPEQG-GMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSV 249

  Fly   272 LHWYPQPPDWYQPLLYYTSPDNS--SDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFG--INREL 332
            ..:..:.         .|:..|.  ..|||:.|::|:.....:.:|:.|.:|:||.||  .|..|
  Rat   250 GLFIKEA---------MTNQPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHVFNDAL 305

  Fly   333 GPLP 336
            ..||
  Rat   306 VFLP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 40/126 (32%)
C1galt1c1NP_001025204.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.