DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and C1GALT1C1

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_001011551.1 Gene:C1GALT1C1 / 29071 HGNCID:24338 Length:318 Species:Homo sapiens


Alignment Length:271 Identity:75/271 - (27%)
Similarity:120/271 - (44%) Gaps:46/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELGSVALNVREGYSNLWPKTRAALQ 149
            ||.|::|..||.....|. :|.||.:.|:|..|.|::..|...|:.::.    :::|...|.|.:
Human    68 RVYCIILVKPKDVSLWAA-VKETWTKHCDKAEFFSSENVKVFESINMDT----NDMWLMMRKAYK 127

  Fly   150 YVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEG---YMSGGAGYV 211
            |.:..:..:|:||..|...|:.|:|||:.||...:..:|.|.|:.    :|.|   |:....|.|
Human   128 YAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHT----IKSGDLEYVGMEGGIV 188

  Fly   212 LSKMALHRLIKLGFSNSSI-----CTNRNYGY-----EDVELGRCLAGVGVVGGDSRDEQGLSRF 266
            ||..::.||      ||.:     |..:. |.     ||.:|..||...||...::.|..|...|
Human   189 LSVESMKRL------NSLLNIPEKCPEQG-GMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVF 246

  Fly   267 ----IPFSPLHWYPQPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKLRIFG 327
                :..|           .:..:.|........|||:.|::|:.....:.:|:.|.:|:||.||
Human   247 NTKSVGLS-----------IKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFG 300

  Fly   328 --INRELGPLP 336
              .|..|..||
Human   301 HIFNDALVFLP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 37/126 (29%)
C1GALT1C1NP_001011551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.