DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and bus-4

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_500615.2 Gene:bus-4 / 188726 WormBaseID:WBGene00044620 Length:368 Species:Caenorhabditis elegans


Alignment Length:253 Identity:81/253 - (32%)
Similarity:133/253 - (52%) Gaps:29/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKADKELG------SVALNVREGYSNLWPKT 144
            :||..:|:...|.||...|..||.|||: ...:.|.:|:.|.      :|...:.|.|..|:.||
 Worm    98 LLCWAMTTSIYHKTRVPAITETWLRRCD-AGHLFTNSDRFLNASTPYHTVFDGLPESYYKLFWKT 161

  Fly   145 RAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMSGGAG 209
            |.||.|:||:..:.:||:.|.|||||.|:|||:.:|...:..:|.:.|.:..:..:.||.:||:|
 Worm   162 RLALLYIYKYVSKDFDWYFKGDDDTYLIVENLQRYLATLDPNKPYFIGYRLSRRTETGYNAGGSG 226

  Fly   210 YVLSKMALHRLIKLGFSNSSICTNRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFSP-LH 273
            ||:|:.|:....:..|::...|.  .:.:||..:.:|||.||:|..|||||:|..||:|:.| .|
 Worm   227 YVMSREAMRIFAEKLFNDKQKCP--YHEWEDYAIAQCLASVGIVPLDSRDEKGRQRFLPWRPEQH 289

  Fly   274 WYP--------QPPDWYQPLLYYTSPDNSSDCCSNTAISFHYNNAQEFYVLEYIIYKL 323
            :|.        .|...:.|.:|:           ...||.|:.:..|..:::.::|.:
 Worm   290 FYADLTRSFQMDPIQVWGPAIYH-----------ENLISMHHLHPDEIRLIDGLLYSI 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 47/129 (36%)
bus-4NP_500615.2 Galactosyl_T 104..>235 CDD:304462 49/131 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163287
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.959148 Normalized mean entropy S7074
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.760

Return to query results.
Submit another query.