DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and T09E11.6

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_493130.2 Gene:T09E11.6 / 188334 WormBaseID:WBGene00011655 Length:494 Species:Caenorhabditis elegans


Alignment Length:110 Identity:26/110 - (23%)
Similarity:50/110 - (45%) Gaps:10/110 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 THHTRAIHIKR-TWGRRCNKLIFMSTKADKELGSVALNVREGYSNLWPKTRAALQYVYKHHFQKY 159
            ||....:.:|: .|.....||....|:.||.|.:..:.:.:|:.:. ..:||:::::    |||.
 Worm   277 THEIGRVDVKKLKWDPMSLKLFINETEMDKLLLTTPMKIVKGWVHC-SLSRASVEWM----FQKL 336

  Fly   160 D---WFLKADDDTYFIMENLRAFLHAH-NFREPVYFGNKFRQHVK 200
            |   :..:.:...|.:.|.....|.|: .|..|.:|.::..|..|
 Worm   337 DPSIFMHQLNQGRYGVDEQYFPILQANAEFGMPGHFTDECLQQGK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 26/110 (24%)
T09E11.6NP_493130.2 Branch 156..419 CDD:280621 26/110 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.959148 Normalized mean entropy S7074
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.