DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2975 and C17A2.3

DIOPT Version :9

Sequence 1:NP_608719.1 Gene:CG2975 / 33481 FlyBaseID:FBgn0031468 Length:385 Species:Drosophila melanogaster
Sequence 2:NP_494669.1 Gene:C17A2.3 / 182699 WormBaseID:WBGene00015871 Length:348 Species:Caenorhabditis elegans


Alignment Length:216 Identity:76/216 - (35%)
Similarity:114/216 - (52%) Gaps:23/216 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RVLCMVLTSPKTHHTRAIHIKRTWGRRCNKLIFMSTKA-----DKELGSVALNVREGYSNLWPKT 144
            ::.|.|.||.|.:..|...:..||..||:...|. ||.     |....:|..|:|:.|.:|:.|:
 Worm   101 QIFCFVETSTKYYKDRVPSVASTWLPRCDHGRFF-TKTHLPYPDIAYSTVYRNLRDTYDDLFRKS 164

  Fly   145 RAALQYVYKHHFQKYDWFLKADDDTYFIMENLRAFLHAHNFREPVYFGNKFRQHVKEGYMSGGAG 209
            ..:|.|.|....:.:||:||.||||:..|::||.:|:..|..||:|.|.:....:..||.|||:|
 Worm   165 IFSLYYSYTSISKHFDWYLKTDDDTFVAMDHLREYLNTLNPAEPLYLGYRLAPFMNNGYNSGGSG 229

  Fly   210 YVLSKMALHRLIKLGFSNSSICT-NRNYGYEDVELGRCLAGVGVVGGDSRDEQGLSRFIPFSPLH 273
            |:||..|:...::..:.|..:|. :|.   ||..:||||..||:...|:||:|.|:||:||.|..
 Worm   230 YILSNAAMRMFVEQLYHNVRLCPYDRG---EDRGMGRCLESVGITPSDTRDDQELNRFMPFRPAE 291

  Fly   274 -------WYPQPPDWYQPLLY 287
                   |:      |.||.|
 Worm   292 IPIIGSKWH------YFPLKY 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2975NP_608719.1 Galactosyl_T 90..>214 CDD:304462 47/128 (37%)
C17A2.3NP_494669.1 Galactosyl_T 98..>239 CDD:304462 50/138 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163232
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.