DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr23B and LOC5667565

DIOPT Version :10

Sequence 1:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster
Sequence 2:XP_001688325.2 Gene:LOC5667565 / 5667565 VectorBaseID:AGAMI1_001760 Length:483 Species:Anopheles gambiae


Alignment Length:41 Identity:9/41 - (21%)
Similarity:16/41 - (39%) Gaps:10/41 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VLALLITALSYSFVPKLKDSFGYL--------IAVHAGTFA 103
            |:|..:|.....|  .:|..:|::        :.||....|
Mosquito    57 VIATKVTGTVKWF--NVKSGYGFINRNDTREDVFVHQSAIA 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:459790
LOC5667565XP_001688325.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.