DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr23B and Cpr78Cc

DIOPT Version :10

Sequence 1:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_649300.1 Gene:Cpr78Cc / 40355 FlyBaseID:FBgn0037069 Length:119 Species:Drosophila melanogaster


Alignment Length:88 Identity:25/88 - (28%)
Similarity:39/88 - (44%) Gaps:11/88 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 PASYSFNYA-VNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNRVP 217
            ||....||. ..:.|.|...:.:...:|  :.|..|.|.|:|...::||.||: :||....:.:|
  Fly    35 PADAEGNYQYAFETSNGIQAQEAGNVNG--ISGSSSYISPEGVPISLTYVADE-NGFQPQGDHLP 96

  Fly   218 YA-------LKAVVVPVAQVAQP 233
            .|       |:|:....|...||
  Fly    97 TAPPIPEAILRALEYIAAHPPQP 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:459790 14/52 (27%)
Cpr78CcNP_649300.1 Chitin_bind_4 42..88 CDD:459790 13/48 (27%)

Return to query results.
Submit another query.