DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr23B and Cpr76Bc

DIOPT Version :10

Sequence 1:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster


Alignment Length:115 Identity:42/115 - (36%)
Similarity:57/115 - (49%) Gaps:22/115 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PSPLPVLRHEQNSEVVSSTQQQQEQQTVQHQQSEPLVVSSVLRQHQEPEVFPPASYSFNYAVNDA 166
            |.|:..:|  ..|.||...:..:..:...|.            :||        .|:|:|.|.|.
  Fly    23 PPPIGAVR--GGSPVVVIDEDDETMEYAPHY------------EHQ--------GYAFSYGVKDL 65

  Fly   167 STGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNRV 216
            .|||:|...|:|||..|:|.||:::|||..|||.||||...||||:|..|
  Fly    66 HTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTV 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:459790 27/51 (53%)
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 27/51 (53%)

Return to query results.
Submit another query.