DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr23B and Cpr66D

DIOPT Version :9

Sequence 1:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster


Alignment Length:184 Identity:55/184 - (29%)
Similarity:74/184 - (40%) Gaps:55/184 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 YVAPARNQFTAGSRTASVQASNLLQNAASAANAESVLLPSPLPVLRHEQNSEVVSST-------- 120
            ||||:...:.....          |.||....|::    :|.|..|.:|:|....||        
  Fly    88 YVAPSVRDYQQYQP----------QQAAYRPPAQA----APQPPRRIQQSSYQAPSTSILGKGQH 138

  Fly   121 ----QQQQEQQTVQHQQSEPLVVSSVLRQHQEPEVFPPASYSFNYAVNDASTGDIKEHSETRDGY 181
                |||.|::....|.|                     ||.|.:.|.|....:.:...|.|||.
  Fly   139 KLSLQQQNEEEEYDDQNS---------------------SYQFGFDVKDDEFTNYQNRKEIRDGS 182

  Fly   182 VVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNRVPYALKAVVVPVAQVAQPTP 235
            |::|.||::|.||:.|||.||||...||.|.|.|.|   ..:||.:     |||
  Fly   183 VIKGSYSVVDSDGFIRTVKYTADPKEGFKAEVIREP---TDIVVKI-----PTP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 22/51 (43%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1544103at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.