DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr23B and Cpr64Ac

DIOPT Version :10

Sequence 1:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:79 Identity:41/79 - (51%)
Similarity:47/79 - (59%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PPASYSFNYAVNDASTGDIKEHSETRDGYVVRGFYSLIDPDGYKRTVTYTADDVHGFNAVVNRVP 217
            |...|||:|.|.|..|||.|:..||....||.|.|||.:|||..|.||||||.|:||||||.:..
  Fly    88 PNPQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFNAVVEKKG 152

  Fly   218 YALKAVVVPVAQVA 231
            .|..|:..|...||
  Fly   153 VAAVAIAKPALAVA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:459790 29/51 (57%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.