DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and AT5G57500

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_200558.1 Gene:AT5G57500 / 835854 AraportID:AT5G57500 Length:318 Species:Arabidopsis thaliana


Alignment Length:306 Identity:70/306 - (22%)
Similarity:118/306 - (38%) Gaps:86/306 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 FVLAFVLLLYVYDV-------------SRVTPCWSSTSTMTTATTARIEDGPPPRILCMVLTCPE 72
            |::|..:|.::.::             |.| |..:.:|.....:::.::|  ..|||..:||.|:
plant    19 FIIALCVLAFINEIRFDSLLSFGRCALSNV-PMNNGSSETPLLSSSPVDD--EIRILIGILTLPD 80

  Fly    73 NV--QSLARSVYETW----GQRCS-RLIFA--SSED-----------YEPLGVVGVVEPTGGG-- 115
            ..  :...|.:|.|.    |.:.. :.:|.  :.||           |:.:.::...|....|  
plant    81 QYSRRHFLRMIYGTQNVPDGVKVDVKFVFCNLTKEDQKVLVALEIMRYDDIIILNCNENMNKGKT 145

  Fly   116 ------YEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGY-- 172
                  ..|::|:|        :.....|.:.:|||||||:.:|:|...||.. |...:::||  
plant   146 YTYFSSLPDIFNET--------DAQKPPYHYVMKADDDTYIRLESLVASLRPL-PREDLYYGYVI 201

  Fly   173 ---KMSRYNVSYMSGGASYILSREALHRFATQAYESEVICPQPKK--MGIEDFYMG--------- 223
               .|..: |.||| |..|::|.:    .|....:||:    |||  .|.||...|         
plant   202 PCPSMDPF-VHYMS-GMGYLVSWD----IAVWLKDSEI----PKKHLEGPEDKVFGDWIREGRRG 256

  Fly   224 -------ICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMSDANY 262
                   ..|.|........||.|..||....:..:.|.::...||
plant   257 KNRFNAKWSMYNFPEPPTRCTHELWPDTIAVHLLKNQEKWIRTLNY 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 45/193 (23%)
AT5G57500NP_200558.1 Galactosyl_T 83..225 CDD:419759 36/156 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.