DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and AT5G12460

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_568279.2 Gene:AT5G12460 / 831121 AraportID:AT5G12460 Length:441 Species:Arabidopsis thaliana


Alignment Length:375 Identity:76/375 - (20%)
Similarity:125/375 - (33%) Gaps:117/375 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 SSTSTMTTATTARIEDGPPPRI--LCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEP-- 102
            ||:|:.:.:.:.:|...||..|  |..|:..........|...|.|              :.|  
plant    17 SSSSSSSVSLSLQITREPPTNISHLFFVIVGSTKTWRYRRGYIEPW--------------WRPNI 67

  Fly   103 -LGVVGVVEPTGGGYEDL--W-------NKTREGF---------------RHVWEHYAGDYDWFL 142
             .|.|.:..|.|   .||  |       :..:|.|               :..::..:.:..||:
plant    68 TKGYVFLERPPG---PDLLPWPQQSPPFSVNKESFITNKFKTQIRLFYSLQESFKKASKETRWFV 129

  Fly   143 KADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSR--------YNVSYMSGGASYILSREALHRFA 199
            ..||||...::||...|..::.....:.|.....        :::.|  ||..|.||...:....
plant   130 IGDDDTLFFLDNLVKALDRYNHKKHYYVGMNSENVWSNAIFAFDMGY--GGGGYALSYPTVVTLL 192

  Fly   200 TQAYESEVICPQPKKMGI-EDFYMGICMQNVGVHFVDST-------HALDGD------TKPKFMP 250
            :...|    |.: :.:|: .|.....|:.::|   :|.|       :.|.||      ..|: .|
plant   193 SNMEE----CIK-RYLGVYSDLLSFRCLADLG---IDLTLEKGMHQNDLHGDISGLLSAHPQ-SP 248

  Fly   251 LDLENYMSDANYTIPEWLRLMSL-----------SRVETGLACCS---NYSVAFHYASRERMFLY 301
            |...::....:...|...|..|:           |||.....|..   |:||:..:.       |
plant   249 LISLHHFDVIDPIFPGMNRQQSVNHLMETAKTDQSRVLQQTICYQRGYNWSVSVSWG-------Y 306

  Fly   302 EFLIY-------HLK----VFDP---NQISERGHRSRLTLSD---LTRRF 334
            ...||       |||    .|.|   .:|...|..:|...:|   :.|:|
plant   307 SVHIYQSIYPRSHLKRPLETFRPWKDVRIPAYGFNTRRVTNDPCEMPRQF 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 32/184 (17%)
AT5G12460NP_568279.2 Galactosyl_T <126..>184 CDD:304462 14/59 (24%)
Galactosyl_T 167..416 CDD:304462 44/208 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.