DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and AT4G00295

DIOPT Version :10

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_567166.2 Gene:AT4G00295 / 828072 AraportID:AT4G00295 Length:467 Species:Arabidopsis thaliana


Alignment Length:133 Identity:34/133 - (25%)
Similarity:54/133 - (40%) Gaps:32/133 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 WFLKADDDTYVVMENLQHLLRGFDPNTPVFFG----------YKMSRYNVSYMSGG--ASYILSR 192
            |.:..||||....|||..:||.:|.....:.|          ::.| |.::|..||  .||.|::
plant   179 WVVMGDDDTVFFTENLVRVLRKYDHKQFYYIGAPSESHLQNLHQFS-YGMAYGGGGFAISYPLAK 242

  Fly   193 -------EALHRFA--------TQAYESEVICPQPKKMGIEDF-YMGICMQNVGVH---FVDSTH 238
                   ..:.|::        ..|..:|:..|..|::|...| ..|..:..:.||   .:.|.|
plant   243 VLEKMQDRCIERYSDLYGSDDRIHACMAELGVPLTKEVGFHQFDVYGNLLGLLSVHPQAPIVSIH 307

  Fly   239 ALD 241
            .||
plant   308 HLD 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:473923 30/125 (24%)
AT4G00295NP_567166.2 DUF604 218..467 CDD:461378 22/94 (23%)

Return to query results.
Submit another query.