DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and b3glcta

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001289180.1 Gene:b3glcta / 799443 ZFINID:ZDB-GENE-110411-147 Length:496 Species:Danio rerio


Alignment Length:225 Identity:58/225 - (25%)
Similarity:93/225 - (41%) Gaps:30/225 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 STMTTATTARIEDGPPPR---ILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVV 106
            |..||.::.....|.|.:   |...|.||.:........|.:|||::.|.|.:.|  ||....:.
Zfish   249 SCATTVSSHSPLCGEPVKIENIFVAVKTCKKFHSDRVPVVKKTWGKQASLLEYYS--DYADPSIP 311

  Fly   107 GV---VEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPV 168
            .:   |..|..|:   ..||....|.....:....||.|..||||.:.:..||.||..::.:.|:
Zfish   312 TINLGVPNTERGH---CGKTFAILRRFLSSHVPRTDWLLIVDDDTLISLPRLQALLSCYESSEPL 373

  Fly   169 F----FGYKMSRYNVSYMSGGASYILSREALHRFATQAYESEVICPQPKKMGIEDFYMGICMQNV 229
            .    :||.:.:...||::||...:.||||:.:..:..      |........:|..:|:|:.::
Zfish   374 CLGERYGYGLGQGGYSYITGGGGMLFSREAVVQLLSSG------CNCYSNDAPDDMVLGMCLNSL 432

  Fly   230 GVHFVDSTHALDGDTKPKFMPLDLENYMSD 259
            .   |..||:      |.|.....|:|..|
Zfish   433 R---VPVTHS------PLFHQARPEDYARD 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 38/155 (25%)
b3glctaNP_001289180.1 Galactosyl_T 265..468 CDD:304462 53/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.