DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and b3glct

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_031751983.1 Gene:b3glct / 780006 XenbaseID:XB-GENE-951583 Length:518 Species:Xenopus tropicalis


Alignment Length:300 Identity:66/300 - (22%)
Similarity:110/300 - (36%) Gaps:86/300 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 FMAGFVLAFVLL-------------------------LYVY---DVSRVT---------PCWSST 44
            |.||:.|:..|:                         ||::   |...:|         |..|..
 Frog   204 FAAGWALSMPLVRRLSDVLLRDPPSSDFTIDLKHEIALYIWKKLDGQELTHVKQFCSEDPTSSKA 268

  Fly    45 STMTTATTARIE-DGPPPR---ILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGV 105
            :...||..:.:. .|.|.:   :...:.||.:..:.....|.:||.::.:...:.|  ||....:
 Frog   269 AECATAFNSALPVCGSPVQKEDMFVAIKTCRKFHKDRVPVVKKTWEKQATHYEYYS--DYADNTI 331

  Fly   106 VGVVEPTGGGYEDL---------WNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRG 161
                 ||.    ||         ..||........|.|.|...|.:..||||.:.:..||.||..
 Frog   332 -----PTA----DLRIPNVERGHCGKTFAILERFMELYVGRMSWLIIVDDDTLISLPRLQKLLGC 387

  Fly   162 FDPNTPVF----FGYKMSRYNVSYMSGGASYILSREALHRFAT---QAYESEVICPQPKKMGIED 219
            ::|:..||    :||.:.....:|::||...:.||||:.|...   :.|.::.    |     :|
 Frog   388 YNPHQAVFLGERYGYGLQAGGYNYITGGGGMVFSREAVRRLMNSKCRCYSNDA----P-----DD 443

  Fly   220 FYMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMSD 259
            ..:|:|..::|   :..||:      |.|......:|..|
 Frog   444 MVLGMCFSSLG---ITVTHS------PLFHQARPTDYAKD 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 40/164 (24%)
b3glctXP_031751983.1 Fringe 286..489 CDD:367085 50/217 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.