DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and C1GALT1C1L

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001094800.1 Gene:C1GALT1C1L / 728819 HGNCID:51617 Length:315 Species:Homo sapiens


Alignment Length:283 Identity:66/283 - (23%)
Similarity:126/283 - (44%) Gaps:34/283 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 MTTATTARIEDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASSEDYEPLGVVGVVEP 111
            :.|:....:|.....|:.|::....|: :|....:.|||.:.|.:.....:::.....:..    
Human    54 LNTSKVILLELSKSIRVFCIIFGESED-ESYWAVLKETWTKHCDKAELYDTKNDNLFNIES---- 113

  Fly   112 TGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGFDPNTPVFFGYKMSR 176
                 .|.|.:.|..:::|:|.|..:|:||..|...|:.|:|||::||...|.:.|.:.|:.:..
Human   114 -----NDRWVQMRTAYKYVFEKYGDNYNWFFLALPTTFAVIENLKYLLFTRDASQPFYLGHTVIF 173

  Fly   177 YNVSYMSGGASYILSREALHRFATQAYESEVICPQPK--KMGIEDFYMGICMQNVGVHFVDSTHA 239
            .::.|::.....:||||.:.|.......||....|..  |:. ||..:.||::..|||   :.:|
Human   174 GDLEYVTVEGGIVLSRELMKRLNRLLDNSETCADQSVIWKLS-EDKQLAICLKYAGVH---AENA 234

  Fly   240 LDGDTKPKFMPLDLENYMSDANYTIPEWLRLMSLSRVETGLACCSNYSVAFHYASRERMFLYEFL 304
            .|.:.:..|....:...:.:|....|:.:       ||   .|||:.::.|:..:.::|.:..:.
Human   235 EDYEGRDVFNTKPIAQLIEEALSNNPQQV-------VE---GCCSDMAITFNGLTPQKMEVMMYG 289

  Fly   305 IYHLKVFDPNQISERGHRSRLTL 327
            :|.|:.|        ||....||
Human   290 LYRLRAF--------GHYFNDTL 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 38/150 (25%)
C1GALT1C1LNP_001094800.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.