DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3119 and C1galt1c1

DIOPT Version :9

Sequence 1:NP_608717.2 Gene:CG3119 / 33479 FlyBaseID:FBgn0031466 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_067525.1 Gene:C1galt1c1 / 59048 MGIID:1913493 Length:316 Species:Mus musculus


Alignment Length:296 Identity:76/296 - (25%)
Similarity:137/296 - (46%) Gaps:52/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DVSRVTPCWSSTSTMTTATTARIEDGPPPRILCMVLTCPENVQSLARSVYETWGQRCSRLIFASS 97
            |:|::            :...|:|.....|:.|:||..|::| ||..:|.|||.:.|.:..|.||
Mouse    49 DISKI------------SEAERMELSKSFRVYCIVLVKPKDV-SLWAAVKETWTKHCDKAEFFSS 100

  Fly    98 EDYEPLGVVGVVEPTGGGYEDLWNKTREGFRHVWEHYAGDYDWFLKADDDTYVVMENLQHLLRGF 162
            |:      |.|.|.......|:|...|:.:::.::.|...|:||..|...|:.|:|||::.|...
Mouse   101 EN------VKVFESINMDTNDMWLMMRKAYKYAYDQYRDQYNWFFLARPTTFAVIENLKYFLLKK 159

  Fly   163 DPNTPVFFGYKMSRYNVSYMSGGASYILSREALHRFATQAYESEVICPQ--PKKMGI-----EDF 220
            |.:.|.:.|:.:...::.|:|.....:||.|::.|.     .|.:..|:  |::.|:     ||.
Mouse   160 DQSQPFYLGHTVKSGDLEYVSVDGGIVLSIESMKRL-----NSLLSVPEKCPEQGGMIWKISEDK 219

  Fly   221 YMGICMQNVGVHFVDSTHALDGDTKPKFMPLDLENYMSDANYTIPEWLRLMSLSRVETGLACCSN 285
            .:.:|::..||.   :.:|.|.|.|..|....:..::.:|....|        ::|..|  |||:
Mouse   220 QLAVCLKYAGVF---AENAEDADGKDVFNTKSVGLFIKEAMTNQP--------NQVVEG--CCSD 271

  Fly   286 YSVAFHYASRERMFLYEFLIYHLKVFDPNQISERGH 321
            .:|.|:..:..:|.:..:.:|.|:.|        ||
Mouse   272 MAVTFNGLTPNQMHVMMYGVYRLRAF--------GH 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3119NP_608717.2 Galactosyl_T 86..235 CDD:304462 40/155 (26%)
C1galt1c1NP_067525.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2246
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.